Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBL100W-C  from Saccharomyces cerevisiae S288C
>YBL100W-C|YBL100W-C YBL100W-C SGDID:S000028598, Chr II from 28427-28546, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (39 aa)
MSRSIFFFSSLFLSPLNKIRNIGGKVENPWKSQIRDWKN