Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL091C-A  from Saccharomyces cerevisiae S288C
>YBL091C-A|YBL091C-A SCS22 SGDID:S000007228, Chr II from 47058-46565,47180-47147, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in regulation of phospholipid metabolism; homolog of Scs2p; similar to D. melanogaster inturned protein" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MRIVPEKLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVN
VQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLEEQYKDDIVF
KKIKIFHSVLPKRKPSGNHDAESARAPSAGNGQSLSSRALLIITVIALLVGWIYY