Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL087C  from Saccharomyces cerevisiae S288C
>YBL087C|YBL087C RPL23A SGDID:S000000183, Chr II from 60193-59822,60739-60698, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl23Bp and has similarity to E. coli L14 and rat L23 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (137 aa)
MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMA
TVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGK
ECADLWPRVASNSGVVV