Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL078C  from Saccharomyces cerevisiae S288C
>YBL078C|YBL078C ATG8 SGDID:S000000174, Chr II from 80731-80378, Genome Release 64-1-1, reverse complement, Verified ORF, "Component of autophagosomes and Cvt vesicles; undergoes conjugation to phosphatidylethanolamine (PE); Atg8p-PE is anchored to membranes, is involved in phagophore expansion, and may mediate membrane fusion during autophagosome formation" ORGANISM: Saccharomyces cerevisiae S288C (117 aa)
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQF
VYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR