Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL071W-A  from Saccharomyces cerevisiae S288C
>YBL071W-A|YBL071W-A KTI11 SGDID:S000007587, Chr II from 89978-90226, Genome Release 64-1-1, Verified ORF, "Zn-ribbon protein that co-purifies with Dph1 and Dph2 in a complex required for synthesis of diphthamide on translation factor eEF2 and with Elongator subunits Iki3p, Elp2p, and Elp3p involved in modification of wobble nucleosides in tRNAs" ORGANISM: Saccharomyces cerevisiae S288C (82 aa)
MSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCSLMIDVVFDK
EDLAEYYEEAGIHPPEPIAAAA