Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBL071C-B  from Saccharomyces cerevisiae S288C
>YBL071C-B|YBL071C-B YBL071C-B SGDID:S000028597, Chr II from 89556-89458, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (32 aa)
MELFHIRYLQAYLKVIGNYTCHLLFGTHKKTL