Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL059C-A  from Saccharomyces cerevisiae S288C
>YBL059C-A|YBL059C-A CMC2 SGDID:S000007488, Chr II from 110420-110125,110539-110506, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of the mitochondrial intermembrane space with a role in respiratory chain complex assembly or maintenance; contains twin Cx9C motifs that can form coiled coil-helix-coiled-coil helix fold" ORGANISM: Saccharomyces cerevisiae S288C (109 aa)
MHPQLEAERFHSCLDFINALDKCHQKEYYKRIFGLCNNEKDALNKCLKEASLNNKKRAVI
ESRIKRADVEKRWKKIEEEEYGEDAILKTILDRQYAKKKQESDNDANSK