Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL040C  from Saccharomyces cerevisiae S288C
>YBL040C|YBL040C ERD2 SGDID:S000000136, Chr II from 142749-142112,142868-142847, Genome Release 64-1-1, reverse complement, Verified ORF, "HDEL receptor, an integral membrane protein that binds to the HDEL motif in proteins destined for retention in the endoplasmic reticulum; has a role in maintenance of normal levels of ER-resident proteins" ORGANISM: Saccharomyces cerevisiae S288C (219 aa)
MNPFRILGDLSHLTSILILIHNIKTTRYIEGISFKTQTLYALVFITRYLDLLTFHWVSLY
NALMKIFFIVSTAYIVVLLQGSKRTNTIAYNEMLMHDTFKIQHLLIGSALMSVFFHHKFT
FLELAWSFSVWLESVAILPQLYMLSKGGKTRSLTVHYIFAMGLYRALYIPNWIWRYSTED
KKLDKIAFFAGLLQTLLYSDFFYIYYTKVIRGKGFKLPK