Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL029C-A  from Saccharomyces cerevisiae S288C
>YBL029C-A|YBL029C-A YBL029C-A SGDID:S000007591, Chr II from 164772-164488, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; has potential orthologs in Saccharomyces species and in Yarrowia lipolytica" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MSFIPIVCGMKSFDSSYDTVPGHQNLYCPNCHNYSVGPIKRKEFFTIWFIPLVPVFWGKQ
LHCPICNWRQDFKNDEQLNKVIQEQQNLRQKQPN