Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL028C  from Saccharomyces cerevisiae S288C
>YBL028C|YBL028C YBL028C SGDID:S000000124, Chr II from 167838-167518, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function that may interact with ribosomes; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus; predicted to be involved in ribosome biogenesis" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MAKSLRASSHLNAKSVKRRGVFQKAVDAREQRISDKLKEDLLKQKLEDLKKKEEQGIDMD
VDEKKSNEEAPRKKISTSGWRDGRHHTYKKAKLMKQSKKKTSFTRF