>YBL026W|YBL026W LSM2 SGDID:S000000122, Chr II from 170623-170676,170805-171038, Genome Release 64-1-1, Verified ORF, "Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA" ORGANISM: Saccharomyces cerevisiae S288C (95 aa)
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNI
FIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK