Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL026W  from Saccharomyces cerevisiae S288C
>YBL026W|YBL026W LSM2 SGDID:S000000122, Chr II from 170623-170676,170805-171038, Genome Release 64-1-1, Verified ORF, "Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA" ORGANISM: Saccharomyces cerevisiae S288C (95 aa)
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNI
FIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK