Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL025W  from Saccharomyces cerevisiae S288C
>YBL025W|YBL025W RRN10 SGDID:S000000121, Chr II from 171481-171918, Genome Release 64-1-1, Verified ORF, "Protein involved in promoting high level transcription of rDNA, subunit of UAF (upstream activation factor) for RNA polymerase I" ORGANISM: Saccharomyces cerevisiae S288C (145 aa)
MDRNVYEACSNIIKEFGTHVVSADEVLAEKIDNAVPIPFKTREEIDADVEKDRNEGVFEG
NIIPDIDLRVVHYYATQLCLNKYPHLINAFDETSLITLGLLIEKWVKDYLTSIQTEQGRQ
SKVIGKGPCEFISKHIDYRHAPGNI