Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL018C  from Saccharomyces cerevisiae S288C
>YBL018C|YBL018C POP8 SGDID:S000000114, Chr II from 186352-185998,186474-186428, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of both RNase MRP and nuclear RNase P; RNase MRP cleaves pre-rRNA, while nuclear RNase P cleaves tRNA precursors to generate mature 5' ends and facilitates turnover of nuclear RNAs" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MGKKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFGEGVEYSFLHV
DDKLAYIRVNHADKDTFSSSISTYISTDELVGSPLTVSILQESSSLRLLEVTDDDRLWLK
KVMEEEEQDCKCI