Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBL001C  from Saccharomyces cerevisiae S288C
>YBL001C|YBL001C ECM15 SGDID:S000000097, Chr II from 237467-237153, Genome Release 64-1-1, reverse complement, Verified ORF, "Non-essential protein of unknown function, likely exists as tetramer, may be regulated by the binding of small-molecule ligands (possibly sulfate ions), may have a role in yeast cell-wall biogenesis" ORGANISM: Saccharomyces cerevisiae S288C (104 aa)
MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLI
GEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ