Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YAR029W  from Saccharomyces cerevisiae S288C
>YAR029W|YAR029W YAR029W SGDID:S000000077, Chr I from 186321-186545, Genome Release 64-1-1, Uncharacterized ORF, "Member of DUP240 gene family but contains no transmembrane domains; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" ORGANISM: Saccharomyces cerevisiae S288C (74 aa)
MNKYLFDHKIWSTPYYFYCEEDCHRLFLSFIEGRTFEKPTSNAEENVQETEAGESFTLNP
GEDFQNCFPRQRIL