Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YAR020C  from Saccharomyces cerevisiae S288C
>YAR020C|YAR020C PAU7 SGDID:S000000073, Chr I from 177023-176856, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of the seripauperin multigene family, active during alcoholic fermentation, regulated by anaerobiosis, inhibited by oxygen, repressed by heme" ORGANISM: Saccharomyces cerevisiae S288C (55 aa)
MVKLTSIAAGVAAIAAGASAAATTTLSQSDERVNLVELGVYVSDIRAHLAEYYSF