Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YAL067W-A  from Saccharomyces cerevisiae S288C
>YAL067W-A|YAL067W-A YAL067W-A SGDID:S000028593, Chr I from 2480-2707, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (75 aa)
MPIIGVPRCLIKPFSVPVTFPFSVKKNIRILDLDPRTEAYCLSLNSVCFKRLPRRKYFHL
LNSYNIKRVLGVVYC