Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YAL064W  from Saccharomyces cerevisiae S288C
>YAL064W|YAL064W YAL064W SGDID:S000000060, Chr I from 21566-21850, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; may interact with ribosomes, based on co-purification experiments" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MNPFASLEGQDNISSVFFLHMQQFESQVKDRFRFPIFRLERKTFGNSCYQVETLKVKCRP
RHAKSCNLLTLLFKSRTQSVLVPNFGFLILNSEP