Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YAL064C-A  from Saccharomyces cerevisiae S288C
>YAL064C-A|YAL064C-A TDA8 SGDID:S000002140, Chr I from 13743-13363, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; null mutant is sensitive to expression of the top1-T722A allele; not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (126 aa)
MTGYFLPPQTSSYTFRFAKVDDSAILSVGGDVAFGCCAQEQPPITSTNFTINGIKPWQGR
LPDNIAGTVYMYAGFYCPMKIVYSNAVSWHTLPVSVELPDVTTVSDDFAGHVYSFDDDLT
AQLYYP