Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YAL046C  from Saccharomyces cerevisiae S288C
>YAL046C|YAL046C AIM1 SGDID:S000000044, Chr I from 57385-57029, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in mitochondrial function or organization; null mutant displays elevated frequency of mitochondrial genome loss" ORGANISM: Saccharomyces cerevisiae S288C (118 aa)
MKLPQTMLRSISVKHVRWPRILTGSKLWYSTQMAMTPEEKMITDKLQQELEPEVCKVQDV
SGGCGSMFAINITSKKFNGLSLIKQHQLVNRILRDDISRWHGLQLTTKKSTGKGPASS