Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YAL037C-A  from Saccharomyces cerevisiae S288C
>YAL037C-A|YAL037C-A YAL037C-A SGDID:S000028732, Chr I from 73518-73426, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (30 aa)
MSISFPKMQHLIVMTTIGDKKVNNNIILFL