Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus R0030W  from Saccharomyces cerevisiae S288C
>R0030W|R0030W RAF1 SGDID:S000029674, 2-micron plasmid from 3271-3816, Genome Release 64-1-1, Verified ORF, "Anti-repressor that increases 2 micron plasmid copy number by relieving repression of the FLP1 site-specific recombinase caused by the Rep1-Rep2p trascription regulator; also itself repressed by the Rep1p-Rep2p complex" ORGANISM: Saccharomyces cerevisiae S288C (181 aa)
MPYKTAIDCIEELATQCFLSKLTDDDVSTFRRVCSKENDIIKLALRIPRTIDYTSILRLL
YDTLPLRSLSFNEALPLFCYSIDPAQQRQCDLRFYLRDVVKLARPRKRLEMQKALLQWLP
SLLSDVTLQLLNDIRIRFEEIQPNIRQTVLQIYDRTCYPSLNFEHPNLGVFPETDSIFEP
V