Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus Q0130  from Saccharomyces cerevisiae S288C
>Q0130|Q0130 OLI1 SGDID:S000007274, Chr Mito from 46723-46953, Genome Release 64-1-1, Verified ORF, "F0-ATP synthase subunit c (ATPase-associated proteolipid), encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2" ORGANISM: Saccharomyces cerevisiae S288C (76 aa)
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA
TGLFCLMVSFLLLFGV