Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus Q0080  from Saccharomyces cerevisiae S288C
>Q0080|Q0080 ATP8 SGDID:S000007267, Chr Mito from 27666-27812, Genome Release 64-1-1, Verified ORF, "Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome; ATP8 and ATP6 mRNAs are not translated in the absence of the F1 sector of ATPase" ORGANISM: Saccharomyces cerevisiae S288C (48 aa)
MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL