Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus SCRG_04550  from Saccharomyces cereviecea RM11-1a
>SCRG_04550| hypothetical protein similar to integral membrane protein required for ER to Golgi transport ORGANISM: Saccharomyces cereviecea RM11-1a (85 aa)
MVLFGLGRLFYVILLLINAVAVLSEERFLRRIGLGRSNDETPVFGQDQNTTKSKVVQLIG
AVQTLLRIPLIGINILVIVYELLLG