Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus SCRG_01791  from Saccharomyces cereviecea RM11-1a
>SCRG_01791| hypothetical protein similar to defines a new subfamily of the split beta-alpha-beta sandwiches. ORGANISM: Saccharomyces cereviecea RM11-1a (105 aa)
MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELVLPFNVDELDELNTWFDKF
DAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVDENN