Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus CAWG_01327  from Candida albicans WO1
>CAWG_01327| hypothetical protein similar to protein required for growth of cells lacking the mitochondrial genome ORGANISM: Candida albicans WO1 (106 aa)
MPPVQQYQYAGHQPSNWDKFKMGAIMGSTVGVCVGVLFGGFSILQNGAGPNGVMRTLGQY
IMGSVGTFGLFMSIGSVIRSESGFQNYEKSMVAMQRAKLRAIYRDE