Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus ERGO0G16984g  from Ashbya gossypii
>ERGO0G16984g|[shbya gossypii] AGOS_AGR387C AGR387C AGOS_AGR387C, Syntenic homolog of Saccharomyces cerevisiae YDL120W (YFH1) Newly annotated start codon according to experimentaly determined 5' end of mRNA using 5' RACE. ORGANISM: Ashbya gossypii (119 aa)
MRAPPELAQLTPQAYHKQADEFLNDLLDRLEALGDERPDIIADSEYSQGVLTLSVPALGT
YVINKQPPNKQIWLSSPVSGPNRYDLIDGEWVSLRDGSRLMAVLSRELGRALDNPDYAL